Pay in 4 interest-free payments of $42.82 Learn more
Ships within 48 hours · Estimated delivery Jul 28 - Aug 2
Prostaglandin E2 binds to four G protein-coupled E-prostanoid receptors
AVIDELMQALNFNSEt VPQKSSLEEPDFYKTKIKLCILLHAFRIRAVTIDRVMSYLNAS
GeneID: 375616
Immunogen: Purified recombinant fragment of human PTK6 expressed in E
Gene Name: TFAM
TIM-3/HAVCR2 Polyclonal Antibody-BS79817 BioWorld Prostaglandin E2 binds to fourTIM 3 HAVCR2 Polyclonal Antibody Sizes: 50l, 100l Catalogue Numbers: BS79817 50, BS79817 100 Product: 1mg ml in PBS with 0. 02% sodium azide, 50% glycerol, pH7. 2 Swiss Prot: Q8TDQ0 Host: Rabbit Reactivity: Human Applications: IHC All Applications: IHC,1: 50 1: 200 Background: The protein encoded by this gene belongs to the immunoglobulin superfamily, and TIM family of proteins. CD4 positive T helper lymphocytes can be divided into types 1 (Th1) and 2